SEC14 like protein 2 (SEC14L2) (NM_012429) Human Recombinant Protein
CAT#: TP315994
Recombinant protein of human SEC14-like 2 (S. cerevisiae) (SEC14L2), transcript variant 1, 20 µg
View other "SEC14 like protein 2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215994 representing NM_012429
Red=Cloning site Green=Tags(s) MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDN IISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTT KLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLS EDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEH SVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED GTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036561 |
| Locus ID | 23541 |
| UniProt ID | O76054 |
| Refseq Size | 2818 |
| Cytogenetics | 22q12.2 |
| Refseq ORF | 1209 |
| Synonyms | C22orf6; SPF; TAP; TAP1 |
| Summary | This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415756 | SEC14L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415756 | Transient overexpression lysate of SEC14-like 2 (S. cerevisiae) (SEC14L2), transcript variant 1 |
CNY 3080.00 |
|
| PH315994 | SEC14L2 MS Standard C13 and N15-labeled recombinant protein (NP_036561) |
CNY 19520.00 |
其它SEC14 like protein 2产品
