Septin 3 (SEPT3) (NM_145733) Human Recombinant Protein
CAT#: TP315771
Recombinant protein of human septin 3 (SEPT3), transcript variant A, 20 µg
View other "Septin 3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215771 representing NM_145733
Red=Cloning site Green=Tags(s) MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVP ATPCPTAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663786 |
Locus ID | 55964 |
UniProt ID | Q9UH03 |
Refseq Size | 2469 |
Cytogenetics | 22q13.2 |
Refseq ORF | 1074 |
Synonyms | bK250D10.3; SEP3; SEPT3 |
Summary | This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, May 2018] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403438 | 42250 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412748 | 42250 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403438 | Transient overexpression lysate of septin 3 (SEPT3), transcript variant A |
CNY 3080.00 |
|
LY412748 | Transient overexpression lysate of septin 3 (SEPT3), transcript variant B |
CNY 3080.00 |
|
PH315714 | SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_061979) |
CNY 19520.00 |
|
PH315771 | SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_663786) |
CNY 19520.00 |
|
TP315714 | Recombinant protein of human septin 3 (SEPT3), transcript variant B, 20 µg |
CNY 2900.00 |
其它Septin 3产品