SIVA (SIVA1) (NM_006427) Human Recombinant Protein
CAT#: TP315680
Recombinant protein of human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1, 20 µg
View other "SIVA" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215680 representing NM_006427
Red=Cloning site Green=Tags(s) MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPES PKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVR TCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006418 |
Locus ID | 10572 |
UniProt ID | O15304 |
Refseq Size | 751 |
Cytogenetics | 14q32.33 |
Refseq ORF | 525 |
Synonyms | CD27BP; SIVA; Siva-1; Siva-2 |
Summary | This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. [provided by RefSeq, Sep 2018] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411940 | SIVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416652 | SIVA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411940 | Transient overexpression lysate of SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2 |
CNY 3080.00 |
|
LY416652 | Transient overexpression lysate of SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 1 |
CNY 3080.00 |
|
PH315680 | SIVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006418) |
CNY 19520.00 |
|
TP761811 | Purified recombinant protein of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |