Ecat1 (KHDC3L) (NM_001017361) Human Recombinant Protein
CAT#: TP315631
Recombinant protein of human chromosome 6 open reading frame 221 (C6orf221), 20 µg
View other "Ecat1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215631 representing NM_001017361
Red=Cloning site Green=Tags(s) MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMS QILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEV REAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDA RDPVTRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001017361 |
Locus ID | 154288 |
UniProt ID | Q587J8 |
Refseq Size | 1063 |
Cytogenetics | 6q13 |
Refseq ORF | 651 |
Synonyms | C6orf221; ECAT1; HYDM2 |
Summary | The protein encoded by this gene belongs to the KHDC1 family, members of which contain an atypical KH domain that may not bind RNA like canonical KH domains. This gene is specifically expressed in the oocytes, and recent studies suggest that it may function as a regulator of genomic imprinting in the oocyte. Mutations in this gene are associated with recurrent biparental complete hydatidiform mole. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400398 | KHDC3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400398 | Transient overexpression lysate of chromosome 6 open reading frame 221 (C6orf221) |
CNY 3080.00 |
|
PH315631 | C6orf221 MS Standard C13 and N15-labeled recombinant protein (NP_001017361) |
CNY 19520.00 |