EBF4 (NM_020833) Human Recombinant Protein
CAT#: TP315467
Purified recombinant protein of Homo sapiens early B-cell factor 4 (EBF4), 20 µg
View other "EBF4" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215467 representing NM_020833
Red=Cloning site Green=Tags(s) MDALPRSGLNLKEEPLLPAGLGSVRSWMQGAGILDASTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLA MYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQAIIYEG QDKNPEMCRVLLTHEIMCSRCCDRKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQV VVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEAATPCIKAISPGEGWTTGGATVIVIGDNFFDG LQVVFGNVLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGCPGRFVYTALNEPTIDYGFQRLQ KVIPRHPGDPERLPKEVLLKRAADLAEALYGVPGSNQELLLKRAADVAEALYSTPRAPGPLAPLAPSHPH PAVVGINAFSSPLAIAVGDATPGPEPGYARSCSSASPRGFAPSPGSQQSGYGGGLGAGLGGYGAPGVAGL GVPGSPSFLNGSTATSPFAKERLRPRAAPPKLPTPGLPQSPRRGASRPVF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.7 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 57593 |
| UniProt ID | Q9BQW3 |
| Refseq Size | 2814 |
| Cytogenetics | 20p13 |
| Refseq ORF | 1620 |
| Synonyms | COE4; early B-cell factor 4; KIAA1442 |
| Summary | EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412258 | EBF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426327 | EBF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412258 | Transient overexpression lysate of early B-cell factor 4 (EBF4) |
CNY 4840.00 |
|
| LY426327 | Transient overexpression lysate of early B-cell factor 4 (EBF4) |
CNY 3080.00 |
|
| PH326006 | EBF4 MS Standard C13 and N15-labeled recombinant protein (NP_001103984) |
CNY 14250.00 |
|
| TP326006 | Recombinant protein of human early B-cell factor 4 (EBF4), 20 µg |
CNY 2900.00 |
