Protein cornichon homolog 2 (CNIH2) (NM_182553) Human Recombinant Protein
CAT#: TP315357
Recombinant protein of human cornichon homolog 2 (Drosophila) (CNIH2), 20 µg
View other "Protein cornichon homolog 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215357 representing NM_182553
Red=Cloning site Green=Tags(s) MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVP EYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLA FYLLSFFYYLYSMVYTLVSF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872359 |
Locus ID | 254263 |
UniProt ID | Q6PI25 |
Refseq Size | 1399 |
Cytogenetics | 11q13.2 |
Refseq ORF | 480 |
Synonyms | CNIH-2; Cnil |
Summary | The protein encoded by this gene is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype. AMPA receptors mediate fast synaptic neurotransmission in the central nervous system. This protein has been reported to interact with the Type I AMPA receptor regulatory protein isoform gamma-8 to control assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405478 | CNIH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405478 | Transient overexpression lysate of cornichon homolog 2 (Drosophila) (CNIH2) |
CNY 3080.00 |
|
PH315357 | CNIH2 MS Standard C13 and N15-labeled recombinant protein (NP_872359) |
CNY 19520.00 |
其它Protein cornichon homolog 2产品