ARFGAP1 (NM_018209) Human Recombinant Protein
CAT#: TP315268
Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, 20 µg
View other "ARFGAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215268 representing NM_018209
Red=Cloning site Green=Tags(s) MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDI ELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAEGREWSLESSPAQNWTPPQPR TLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFLNNAMSSLYSG WSSFTTGASRFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQ GVGSKGWRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWT CADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060679 |
Locus ID | 55738 |
UniProt ID | Q8N6T3 |
Refseq Size | 3250 |
Cytogenetics | 20q13.33 |
Refseq ORF | 1218 |
Synonyms | ARF1GAP; HRIHFB2281 |
Summary | The protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406240 | ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413218 | ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406240 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2 |
CNY 3080.00 |
|
LY413218 | Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1 |
CNY 3080.00 |
|
PH306987 | ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_783202) |
CNY 19520.00 |
|
PH315268 | ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060679) |
CNY 19520.00 |
|
TP306987 | Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它ARFGAP1产品