SSBP1 (NM_003143) Human Recombinant Protein
CAT#: TP315106
Recombinant protein of human single-stranded DNA binding protein 1 (SSBP1), 20 µg
View other "SSBP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215106 representing NM_003143
Red=Cloning site Green=Tags(s) MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDS EVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL SDQTKEKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003134 |
| Locus ID | 6742 |
| UniProt ID | Q04837 |
| Refseq Size | 628 |
| Cytogenetics | 7q34 |
| Refseq ORF | 444 |
| Synonyms | Mt-SSB; mtSSB; SOSS-B1; SSBP |
| Summary | SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 19683501].[supplied by OMIM, Feb 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | DNA replication, Homologous recombination, Mismatch repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401092 | SSBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401092 | Transient overexpression lysate of single-stranded DNA binding protein 1 (SSBP1) |
CNY 3080.00 |
|
| PH315106 | SSBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003134) |
CNY 19520.00 |
