Amylin (IAPP) (NM_000415) Human Recombinant Protein
CAT#: TP315074L
Recombinant protein of human islet amyloid polypeptide precursor (IAPP), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215074 representing NM_000415
Red=Cloning site Green=Tags(s) MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY GKRNAVEVLKREPLNYLPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 3.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000406 |
| Locus ID | 3375 |
| UniProt ID | P10997 |
| Refseq Size | 1462 |
| Cytogenetics | 12p12.1 |
| Refseq ORF | 267 |
| Synonyms | DAP; IAP |
| Summary | This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Maturity onset diabetes of the young |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
