SPAG16 (NM_001025436) Human Recombinant Protein
CAT#: TP315059
Recombinant protein of human sperm associated antigen 16 (SPAG16), transcript variant 2, 20 µg
View other "SPAG16" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215059 representing NM_001025436
Red=Cloning site Green=Tags(s) MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIP EGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKG VTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020607 |
Locus ID | 79582 |
UniProt ID | Q8N0X2 |
Refseq Size | 1296 |
Cytogenetics | 2q34 |
Refseq ORF | 549 |
Synonyms | PF20; WDR29 |
Summary | Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIM, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411248 | SPAG16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC422444 | SPAG16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411248 | Transient overexpression lysate of sperm associated antigen 16 (SPAG16), transcript variant 1 |
CNY 4840.00 |
|
LY422444 | Transient overexpression lysate of sperm associated antigen 16 (SPAG16), transcript variant 2 |
CNY 3080.00 |
|
PH315059 | SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_001020607) |
CNY 19520.00 |
|
PH324705 | SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_078808) |
CNY 19520.00 |
|
TP324705 | Recombinant protein of human sperm associated antigen 16 (SPAG16), transcript variant 1, 20 µg |
CNY 2900.00 |