PMPCB (NM_004279) Human Recombinant Protein
CAT#: TP315039
Recombinant protein of human peptidase (mitochondrial processing) beta (PMPCB), nuclear gene encoding mitochondrial protein, 20 µg
View other "PMPCB" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215039 representing NM_004279
Red=Cloning site Green=Tags(s) MAAAAARVVLSSAARRRLWGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVA SEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLELEIENMGAHLNAYTSREQTV YYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRT ILGPTENIKSISRKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFT GSEIRVRDDKMPLAHLAIAVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSF QSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICE DIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004270 |
| Locus ID | 9512 |
| UniProt ID | O75439 |
| Refseq Size | 1771 |
| Cytogenetics | 7q22.1 |
| Refseq ORF | 1467 |
| Synonyms | Beta-MPP; MAS1; MPP11; MPPB; MPPP52; P-52 |
| Summary | This gene is a member of the peptidase M16 family and encodes a protein with a zinc-binding motif. This protein is located in the mitochondrial matrix and catalyzes the cleavage of the leader peptides of precursor proteins newly imported into the mitochondria, though it only functions as part of a heterodimeric complex. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
GRP75 overexpression rescues frataxin deficiency and mitochondrial phenotypes in Friedreich Ataxia cellular models
,Dong, YN;McMillian, E;Clark, EM;Lin, H;Lynch, DR;,
Hum. Mol. Genet.
,PubMed ID 30590615
[PMPCB]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418095 | PMPCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418095 | Transient overexpression lysate of peptidase (mitochondrial processing) beta (PMPCB), nuclear gene encoding mitochondrial protein |
CNY 4840.00 |
|
| PH315039 | PMPCB MS Standard C13 and N15-labeled recombinant protein (NP_004270) |
CNY 19520.00 |
