DNAJC12 (NM_201262) Human Recombinant Protein
CAT#: TP315035
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2, 20 µg
View other "DNAJC12" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215035 representing NM_201262
Red=Cloning site Green=Tags(s) MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE SRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_957714 |
Locus ID | 56521 |
UniProt ID | Q9UKB3 |
Refseq Size | 786 |
Cytogenetics | 10q21.3 |
Refseq ORF | 321 |
Synonyms | HPANBH4; JDP1 |
Summary | This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404589 | DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411920 | DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404589 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2 |
CNY 3080.00 |
|
LY411920 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1 |
CNY 3080.00 |
|
PH301931 | DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_068572) |
CNY 19520.00 |
|
PH315035 | DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) |
CNY 14250.00 |
|
TP301931 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1, 20 µg |
CNY 2900.00 |
其它DNAJC12产品