GOSR1 (NM_001007024) Human Recombinant Protein
CAT#: TP314955
Recombinant protein of human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3, 20 µg
View other "GOSR1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214955 representing NM_001007024
Red=Cloning site Green=Tags(s) MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETM AIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMG SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001007025 |
| Locus ID | 9527 |
| UniProt ID | O95249 |
| Refseq Size | 5246 |
| Cytogenetics | 17q11.2 |
| Refseq ORF | 750 |
| Synonyms | GOLIM2; GOS-28; GOS28; GOS28/P28; GS28; P28 |
| Summary | This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423566 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423567 | GOSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423566 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 3 |
CNY 3080.00 |
|
| LY423567 | Transient overexpression lysate of golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2 |
CNY 3080.00 |
|
| PH314955 | GOSR1 MS Standard C13 and N15-labeled recombinant protein (NP_001007025) |
CNY 14250.00 |
|
| TP760954 | Purified recombinant protein of Human golgi SNAP receptor complex member 1 (GOSR1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
