DPP8 (NM_130434) Human Recombinant Protein
CAT#: TP314685
Recombinant protein of human dipeptidyl-peptidase 8 (DPP8), transcript variant 1, 20 µg
View other "DPP8" proteins (8)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC214685 representing NM_130434 
Red=Cloning site Green=Tags(s) MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFV KRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLR ERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPD WIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGG KILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQ PFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVMERQRLIESVPDSVTPL IIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKC PIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCC ISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTL YGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEG AFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAPVTLWIF YDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYD LQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 101.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_569118 | 
| Locus ID | 54878 | 
| UniProt ID | Q6V1X1 | 
| Refseq Size | 3146 | 
| Cytogenetics | 15q22.31 | 
| Refseq ORF | 2646 | 
| Synonyms | DP8; DPRP-1; DPRP1; MST097; MSTP097; MSTP135; MSTP141 | 
| Summary | This gene encodes a member of the peptidase S9B family, a small family of dipeptidyl peptidases that are able to cleave peptide substrates at a prolyl bond. The encoded protein shares similarity with dipeptidyl peptidase IV in that it is ubiquitously expressed, and hydrolyzes the same substrates. These similarities suggest that, like dipeptidyl peptidase IV, this protein may play a role in T-cell activation and immune function. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Protease, Transmembrane | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Structures and mechanism of dipeptidyl peptidases 8 and 9, important players in cellular homeostasis and cancer
                                                ,null,
                                                Proceedings of the National Academy of Sciences of the United States of America
                                                ,PubMed ID 29382749
                                                [DPP8]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC403323 | DPP8 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC403668 | DPP8 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC405157 | DPP8 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LC430697 | DPP8 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY403323 | Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY403668 | Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 4 | 
                                                     CNY 3080.00  | 
                                            |
| LY405157 | Transient overexpression lysate of dipeptidyl-peptidase 8 (DPP8), transcript variant 3 | 
                                                     CNY 4840.00  | 
                                            |
| PH314685 | DPP8 MS Standard C13 and N15-labeled recombinant protein (NP_569118) | 
                                                     CNY 19520.00  | 
                                            
