PRDM7 (NM_052996) Human Recombinant Protein
CAT#: TP314678
Recombinant protein of human PR domain containing 7 (PRDM7), transcript variant 2, 20 µg
View other "PRDM7" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214678 protein sequence
Red=Cloning site Green=Tags(s) MCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPY EGRITEDEEAANSGYSWLITKGRNCYEYVDGKDKSSANWMRTKARDPSMSLMLSGLFKSKISQSTCGTQS LLSELPRTICKKTSPTRESLPRGSESGAAIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443722 |
Locus ID | 11105 |
UniProt ID | Q9NQW5 |
Refseq Size | 2504 |
Cytogenetics | 16q24.3 |
Refseq ORF | 513 |
Synonyms | PFM4; ZNF910 |
Summary | This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and may function as a histone methyltransferase. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409349 | PRDM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420546 | PRDM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409349 | Transient overexpression lysate of PR domain containing 7 (PRDM7), transcript variant 2 |
CNY 3080.00 |
|
LY420546 | Transient overexpression lysate of PR domain containing 7 (PRDM7), transcript variant 1 |
CNY 4840.00 |
|
PH314678 | PRDM7 MS Standard C13 and N15-labeled recombinant protein (NP_443722) |
CNY 19520.00 |