RIC8 (RIC8B) (NM_018157) Human Recombinant Protein
CAT#: TP314610
Recombinant protein of human resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B), 20 µg
View other "RIC8" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214610 representing NM_018157
Red=Cloning site Green=Tags(s) MDEERALYIVRAGEAGAIERVLRDYSDKHRATFKFESTDEDKRKKLCEGIFKVLIKDIPTTCQVSCLEVL RILSRDKKVLVPVTTKENMQILLRLAKLNELDDSLEKVSEFPVIVESLKCLCNIVFNSQMAQQLSLELNL AAKLCNLLRKCKDRKFINDIKCFDLRLLFLLSLLHTDIRSQLRYELQGLPLLTQILESAFSIKWTDEYES AIDHNGPPLSPQETDCAIEALKALFNVTVDSWKVHKESDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSN AVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFME KRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGV KQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPKEELLKP MGLKPDGTITPLEEALNQYSVIEETSSDTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060627 |
| Locus ID | 55188 |
| UniProt ID | Q9NVN3 |
| Refseq Size | 4989 |
| Cytogenetics | 12q23.3 |
| Refseq ORF | 1560 |
| Synonyms | hSyn; RIC8 |
| Summary | Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413256 | RIC8B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY413256 | Transient overexpression lysate of resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B) |
CNY 4840.00 |
|
| PH314610 | RIC8B MS Standard C13 and N15-labeled recombinant protein (NP_060627) |
CNY 19520.00 |
|
| TP762690 | Purified recombinant protein of Human resistance to inhibitors of cholinesterase 8 homolog B (C. elegans) (RIC8B), full length, with N-GST and C-His tag, expressed in E.coli, 50ug |
CNY 2480.00 |
