RBP1 (NM_002899) Human Recombinant Protein
CAT#: TP314515L
Recombinant protein of human retinol binding protein 1, cellular (RBP1), transcript variant 1, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214515 representing NM_002899
Red=Cloning site Green=Tags(s) MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme activity regulator (PMID: 25502770) |
| Reference Data | |
| RefSeq | NP_002890 |
| Locus ID | 5947 |
| UniProt ID | P09455 |
| Refseq Size | 720 |
| Cytogenetics | 3q23 |
| Refseq ORF | 405 |
| Synonyms | CRABP-I; CRBP; CRBP1; CRBPI; RBPC |
| Summary | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
Documents
| FAQs |
| SDS |


