UHRF1 (NM_013282) Human Recombinant Protein
CAT#: TP314251
Recombinant protein of human ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 2, 20 µg
View other "UHRF1" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC214251 representing NM_013282 
Red=Cloning site Green=Tags(s) MGVFAVPPLSSDTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHT LFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMW DETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVV QMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLN DCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECD MAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRT KECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFT YTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKY APAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALAN REREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIRED KSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVF SCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 90.9 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_037414 | 
| Locus ID | 29128 | 
| UniProt ID | Q96T88 | 
| Refseq Size | 4086 | 
| Cytogenetics | 19p13.3 | 
| Refseq ORF | 2418 | 
| Synonyms | hNP95; hUHRF1; huNp95; ICBP90; Np95; RNF106; TDRD22 | 
| Summary | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. [provided by RefSeq, Feb 2014] | 
| Protein Families | Druggable Genome, Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC415692 | UHRF1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC420780 | UHRF1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY415692 | Transient overexpression lysate of ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| LY420780 | Transient overexpression lysate of ubiquitin-like with PHD and ring finger domains 1 (UHRF1), transcript variant 1 | 
                                                     CNY 4840.00  | 
                                            |
| PH314251 | UHRF1 MS Standard C13 and N15-labeled recombinant protein (NP_037414) | 
                                                     CNY 19520.00  | 
                                            
