CLLD7 (RCBTB1) (NM_018191) Human Recombinant Protein
CAT#: TP314169
Recombinant protein of human regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 (RCBTB1), 20 µg
View other "CLLD7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214169 representing NM_018191
Red=Cloning site Green=Tags(s) MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEG LCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVVEVACGSHHS MALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGN GQLGLGNNGNQLTPVRVAALHSVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIM VEKERVVEIAACHSAHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEH EDFLTVAESLKKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEF CFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060661 |
Locus ID | 55213 |
UniProt ID | Q8NDN9 |
Refseq Size | 4042 |
Cytogenetics | 13q14.2 |
Refseq ORF | 1593 |
Synonyms | CLLD7; CLLL7; GLP; RDEOA |
Summary | This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413236 | RCBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY413236 | Transient overexpression lysate of regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 (RCBTB1) |
CNY 4840.00 |
|
PH314169 | RCBTB1 MS Standard C13 and N15-labeled recombinant protein (NP_060661) |
CNY 19520.00 |