C5ORF33 (NADK2) (NM_001085411) Human Recombinant Protein
CAT#: TP314147
Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 1, 20 µg
View other "C5ORF33" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214147 representing NM_001085411
Red=Cloning site Green=Tags(s) MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN DGAIASMMINKEDELRTVLLEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001078880 |
| Locus ID | 133686 |
| UniProt ID | Q4G0N4 |
| Refseq Size | 3898 |
| Cytogenetics | 5p13.2 |
| Refseq ORF | 1326 |
| Synonyms | C5orf33; DECRD; MNADK; NADKD1 |
| Summary | This gene encodes a mitochondrial kinase that catalyzes the phosphorylation of NAD to yield NADP. Mutations in this gene result in 2,4-dienoyl-CoA reductase deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407195 | NADK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421290 | NADK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY407195 | Transient overexpression lysate of chromosome 5 open reading frame 33 (C5orf33), transcript variant 2 |
CNY 3080.00 |
|
| LY421290 | Transient overexpression lysate of chromosome 5 open reading frame 33 (C5orf33), transcript variant 1 |
CNY 4840.00 |
|
| PH314147 | C5orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001078880) |
CNY 19520.00 |
|
| TP760230 | Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760315 | Recombinant protein of human chromosome 5 open reading frame 33 (C5orf33), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它C5ORF33产品
