DPP6 (NM_130797) Human Recombinant Protein
CAT#: TP314014
Purified recombinant protein of Homo sapiens dipeptidyl-peptidase 6 (DPP6), transcript variant 1, 20 µg
View other "DPP6" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214014 representing NM_130797
Red=Cloning site Green=Tags(s) MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQ YQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSED FKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI YQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGK EGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSE NPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKI LAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVP MVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDG TPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQY IDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMT KVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII NFFVECFRIQDKLPTVTAKEDEEED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 97.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570629 |
| Locus ID | 1804 |
| UniProt ID | P42658 |
| Refseq Size | 3712 |
| Cytogenetics | 7q36.2 |
| Refseq ORF | 2595 |
| Synonyms | DPL1; DPPX; MRD33; VF2 |
| Summary | This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
| Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419638 | DPP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422033 | DPP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY419638 | Transient overexpression lysate of dipeptidyl-peptidase 6 (DPP6), transcript variant 2 |
CNY 4840.00 |
|
| LY422033 | Transient overexpression lysate of dipeptidyl-peptidase 6 (DPP6), transcript variant 3 |
CNY 4840.00 |
|
| PH314014 | DPP6 MS Standard C13 and N15-labeled recombinant protein (NP_570629) |
CNY 14250.00 |
|
| PH316875 | DPP6 MS Standard C13 and N15-labeled recombinant protein (NP_001927) |
CNY 14250.00 |
|
| PH316919 | DPP6 MS Standard C13 and N15-labeled recombinant protein (NP_001034439) |
CNY 19520.00 |
|
| TP316875 | Recombinant protein of human dipeptidyl-peptidase 6 (DPP6), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP316919 | Recombinant protein of human dipeptidyl-peptidase 6 (DPP6), transcript variant 3, 20 µg |
CNY 2900.00 |
