ATPase Inhibitory Factor 1 (ATPIF1) (NM_178191) Human Recombinant Protein
CAT#: TP313993M
Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213993 representing NM_178191
Red=Cloning site Green=Tags(s) MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 3.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_835498 |
| Locus ID | 93974 |
| UniProt ID | Q9UII2 |
| Refseq Size | 1929 |
| Cytogenetics | 1p35.3 |
| Refseq ORF | 180 |
| Synonyms | ATPI; ATPIF1; ATPIP; IP |
| Summary | This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
其它ATPase Inhibitory Factor 1产品
