DCL 1 (CD302) (NM_014880) Human Recombinant Protein
CAT#: TP313785
Recombinant protein of human CD302 molecule (CD302), 20 µg
View other "DCL 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213785 representing NM_014880
Red=Cloning site Green=Tags(s) MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEE ENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKK GNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQ SPYNEDCVLVVGEENEYPVQFD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055695 |
Locus ID | 9936 |
UniProt ID | Q8IX05 |
Refseq Size | 3740 |
Cytogenetics | 2q24.2 |
Refseq ORF | 696 |
Synonyms | BIMLEC; CLEC13A; DCL-1; DCL1 |
Summary | CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402391 | CD302 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434014 | CD302 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402391 | Transient overexpression lysate of CD302 molecule (CD302) |
CNY 3080.00 |
|
LY434014 | Transient overexpression lysate of CD302 molecule (CD302), transcript variant 2 |
CNY 3080.00 |
|
PH313785 | CD302 MS Standard C13 and N15-labeled recombinant protein (NP_055695) |
CNY 19520.00 |