HOXC6 (NM_004503) Human Recombinant Protein
CAT#: TP313768
Recombinant protein of human homeobox C6 (HOXC6), transcript variant 1, 20 µg
View other "HOXC6" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213768 representing NM_004503
Red=Cloning site Green=Tags(s) MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQENVVFSSSRGPY DYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGAD RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGG GGATADSLGGKEEKREETEEEKQKE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004494 |
Locus ID | 3223 |
UniProt ID | P09630 |
Refseq Size | 1681 |
Cytogenetics | 12q13.13 |
Refseq ORF | 705 |
Synonyms | CP25; HHO.C8; HOX3; HOX3C |
Summary | This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401432 | HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403515 | HOXC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401432 | Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 1 |
CNY 3080.00 |
|
LY403515 | Transient overexpression lysate of homeobox C6 (HOXC6), transcript variant 2 |
CNY 3080.00 |
|
PH313768 | HOXC6 MS Standard C13 and N15-labeled recombinant protein (NP_004494) |
CNY 19520.00 |
|
TP761182 | Purified recombinant protein of Human homeobox C6 (HOXC6), transcript variant 2n, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |