Septin 8 (SEPT8) (NM_015146) Human Recombinant Protein
CAT#: TP313550
Purified recombinant protein of Homo sapiens septin 8 (SEPT8), transcript variant 2, 20 µg
View other "Septin 8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213550 representing NM_015146
Red=Cloning site Green=Tags(s) MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFE TEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRR SLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSN GVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREML IRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVN KVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQP LRKDKDKKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055961 |
| Locus ID | 23176 |
| UniProt ID | Q92599 |
| Refseq Size | 4344 |
| Cytogenetics | 5q31.1 |
| Refseq ORF | 1287 |
| Synonyms | SEP2; SEPT8 |
| Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414742 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420343 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420345 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414742 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 2 |
CNY 4840.00 |
|
| LY420343 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 1 |
CNY 4840.00 |
|
| LY420345 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 4 |
CNY 3080.00 |
|
| PH313550 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_055961) |
CNY 14250.00 |
|
| PH316253 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092283) |
CNY 19520.00 |
|
| PH322095 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092281) |
CNY 14250.00 |
|
| TP316253 | Recombinant protein of human septin 8 (SEPT8), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP322095 | Recombinant protein of human septin 8 (SEPT8), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Septin 8产品
