NAA60 (NM_001083601) Human Recombinant Protein
CAT#: TP313483
Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1, 20 µg
View other "NAA60" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213483 protein sequence
Red=Cloning site Green=Tags(s) MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE IKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVL TTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIP HRVYRQAHSLLCSFLPWSGISSKSGIEYSRTM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001077070 |
Locus ID | 79903 |
UniProt ID | Q9H7X0 |
Refseq Size | 2692 |
Cytogenetics | 16p13.3 |
Refseq ORF | 726 |
Synonyms | HAT4; hNaa60; NAT15; NatF |
Summary | This gene encodes an enzyme that localizes to the Golgi apparatus, where it transfers an acetyl group to the N-terminus of free proteins. This enzyme acts on histones, and its activity is important for chromatin assembly and chromosome integrity. Alternative splicing and the use of alternative promoters results in multiple transcript variants. The upstream promoter is located in a differentially methylated region (DMR) and undergoes imprinting; transcript variants originating from this position are expressed from the maternal allele. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411017 | NAA60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421226 | NAA60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421227 | NAA60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411017 | Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2 |
CNY 3080.00 |
|
LY421226 | Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 3 |
CNY 3080.00 |
|
LY421227 | Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1 |
CNY 3080.00 |
|
PH313483 | NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_001077070) |
CNY 19520.00 |
|
PH317832 | NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_079121) |
CNY 19520.00 |
|
PH324843 | NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_001077069) |
CNY 19520.00 |
|
TP317832 | Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP324843 | Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 3, 20 µg |
CNY 2900.00 |