GGA3 (NM_138619) Human Recombinant Protein
CAT＃: TP313361
Recombinant protein of human golgi associated, gamma adaptin ear containing, ARF binding protein 3 (GGA3), transcript variant long, 20 µg
View other "GGA3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213361 representing NM_138619
Red=Cloning site Green=Tags(s) MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLE ACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKR QGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQK VTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDIL QASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPS SGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAP ALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSP LFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVS MLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFAL GEQLSTEVGEVDQFPPVEQWGNL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 78.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_619525 |
| Locus ID | 23163 |
| UniProt ID | Q9NZ52 |
| Refseq Size | 3860 |
| Cytogenetics | 17q25.1 |
| Refseq ORF | 2169 |
| Summary | This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants have been identified in this gene. [provided by RefSeq, Feb 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Lysosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408454 | GGA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC433320 | GGA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433394 | GGA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408454 | Transient overexpression lysate of golgi associated, gamma adaptin ear containing, ARF binding protein 3 (GGA3), transcript variant long |
CNY 4840.00 |
|
| LY433320 | Transient overexpression lysate of golgi-associated, gamma adaptin ear containing, ARF binding protein 3 (GGA3), transcript variant 2 |
CNY 3080.00 |
|
| LY433394 | Transient overexpression lysate of golgi-associated, gamma adaptin ear containing, ARF binding protein 3 (GGA3), transcript variant 1 |
CNY 3080.00 |
|
| PH313361 | GGA3 MS Standard C13 and N15-labeled recombinant protein (NP_619525) |
CNY 19520.00 |
