LOX (NM_002317) Human Recombinant Protein
CAT#: TP313323
Recombinant protein of human lysyl oxidase (LOX), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 14 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213323 representing NM_002317
Red=Cloning site Green=Tags(s) MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSLGSQYQPQRRR DPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPTARHWFQAGYSTSRAREAGAS RAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQY GLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPS RPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.8 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme activity (PMID: 25924936) In vivo treatment (PMID: 26017313) Cell treatment (PMID: 26077591) Binding assay (PMID: 26601954) In vivo treatment (PMID: 28445728) |
| Reference Data | |
| RefSeq | NP_002308 |
| Locus ID | 4015 |
| UniProt ID | P28300 |
| Refseq Size | 1946 |
| Cytogenetics | 5q23.1 |
| Refseq ORF | 1251 |
| Synonyms | AAT10 |
| Summary | This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. The copper-dependent amine oxidase activity of this enzyme functions in the crosslinking of collagens and elastin, while the propeptide may play a role in tumor suppression. In addition, defects in this gene have been linked with predisposition to thoracic aortic aneurysms and dissections. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, Secreted Protein |
Citations (14)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Regulation of Atp7a RNA contributes to differentiation-dependent Cu redistribution in skeletal muscle cells
,null,
Metallomics: Integrated Biometal Science
,PubMed ID 37391383
[LOX]
|
|
Cancer-associated fibroblasts promote oral squamous cell carcinoma progression through LOX-mediated matrix stiffness
,null,
Journal of Translational Medicine
,PubMed ID 34930321
[LOX]
|
|
Downregulation of LOX promotes castration-resistant prostate cancer progression via IGFBP3
,null,
Journal of Cancer
,PubMed ID 35003355
[LOX]
|
|
Enzyme-Initiated Assembly of an Extracellular-Like Two-Dimensional Nanonetwork as a Method to Detect Procancerous Activity
,Cheng, W;Zhou, L;Hu, K;Kong, D;Huang, W;Xu, C;Li, H;Li, J;,
ACS sensors
,PubMed ID 33909412
[LOX]
|
|
Lysyl Oxidase Directly Contributes to Extracellular Matrix Production and Fibrosis in Systemic Sclerosis
,Nguyen, XM;Nishimoto, T;Takihara, T;Mlakar, L;Bradshaw, AD;Feghali-Bostwick, CA;,
Am J Physiol Lung Cell Mol Physiol
,PubMed ID 33026236
[LOX]
|
|
Disrupted copper availability in sporadic ALS: Implications for CuII (atsm) as a treatment option
,Hilton, JBW;Kysenius, K;Liddell, JR;Rautengarten, C;,
BioRxiv
[LOX]
|
|
Lysyl oxidase promotes liver metastasis of gastric cancer via facilitating the reciprocal interactions between tumor cells and cancer associated fibroblasts
,null,
EBioMedicine
,PubMed ID 31678002
[LOX]
|
|
Blocking Surgically Induced Lysyl Oxidase Activity Reduces the Risk of Lung Metastases
,Rachman-Tzemah, C;Zaffryar-Eilot, S;Grossman, M;Ribero, D;Timaner, M;Mäki, JM;Myllyharju, J;Bertolini, F;Hershkovitz, D;Sagi, I;Hasson, P;Shaked, Y;,
Cell Rep
,PubMed ID 28445728
[LOX]
|
|
Characterization of Microfibrillar-Associated Protein 4 (MFAP4) as a Tropoelastin- and Fibrillin-Binding Protein Involved in Elastic Fiber Formation
,Pilecki, B;Holm, AT;Schlosser, A;Moeller, JB;Wohl, AP;Zuk, AV;Heumüller, SE;Wallis, R;Moestrup, SK;Sengle, G;Holmskov, U;Sorensen, GL;,
J. Biol. Chem.
,PubMed ID 26601954
[LOX]
|
|
The hypoxic cancer secretome induces pre-metastatic bone lesions through lysyl oxidase
,Cox, TR;Rumney, RM;Schoof, EM;Perryman, L;Høye, AM;Agrawal, A;Bird, D;Latif, NA;Forrest, H;Evans, HR;Huggins, ID;Lang, G;Linding, R;Gartland, A;Erler, JT;,
Nature
,PubMed ID 26017313
[LOX]
|
|
Targeting the LOX/hypoxia axis reverses many of the features that make pancreatic cancer deadly: inhibition of LOX abrogates metastasis and enhances drug efficacy
,Miller, BW;Morton, JP;Pinese, M;Saturno, G;Jamieson, NB;McGhee, E;Timpson, P;Leach, J;McGarry, L;Shanks, E;Bailey, P;Chang, D;Oien, K;Karim, S;Au, A;Steele, C;Carter, CR;McKay, C;Anderson, K;Evans, TR;Marais, R;Springer, C;Biankin, A;Erler, JT;Sansom, OJ;,
EMBO Mol Med
,PubMed ID 26077591
[LOX]
|
|
Tissue Transglutaminase, Not Lysyl Oxidase, Dominates Early Calcium-Dependent Remodeling of Fibroblast-Populated Collagen Lattices
,Simon, DD;Niklason, LE;Humphrey, JD;,
Cells Tissues Organs (Print)
,PubMed ID 25924936
[LOX]
|
|
Lysyl Oxidase Plays a Critical Role in Endothelial Cell Stimulation to Drive Tumor Angiogenesis
,Ann-Marie Baker, Demelza Bird, Jonathan C. Welti, Morgane Gourlaouen, Georgina Lang, Graeme I. Murray, Andrew R. Reynolds, Thomas R. Cox, and Janine T. Erler,
Cancer Res., Jan 2013; 73: 583 - 594.
[Lox]
|
|
Lysyl oxidase plays a critical role in endothelial cell stimulation to drive tumor angiogenesis
,null,
Cancer research
,PubMed ID 23188504
[LOX]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400843 | LOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400843 | Transient overexpression lysate of lysyl oxidase (LOX) |
CNY 3080.00 |
|
| PH313323 | LOX MS Standard C13 and N15-labeled recombinant protein (NP_002308) |
CNY 19520.00 |
|
| TP700002 | Recombinant protein of N-terminal propeptide (LOXPP) of human lysyl oxidase (LOX), with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP790154 | Purified recombinant protein of Human lysyl oxidase (LOX), with C-terminal DDK tag, secretory expressed in CHO cells, 20ug |
CNY 6650.00 |


