CEACAM20 (NM_001102597) Human Recombinant Protein
CAT#: TP313248
Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 5L, 20 µg
View other "CEACAM20" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213248 representing NM_001102597
Red=Cloning site Green=Tags(s) MGPADSWGHHWMGILLSASLCTVWSPPAAAQLTLNANPLDATQSEDVVLPVFGTPRTPQIHGRSRELAKP SIAVSPGTAIEQKDMVTFYCTTKDVNITIHWVSNNLSVVFHERMQLSKDGKILTILIVQREDSGTYQCEA RDALLSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVMEGSSMTFLAETKSHPPCAYTWFLLDSILSH TTRTFTIHAVSREHEGLYRCLVSNSATHLSSLGTLKVRVLETLTMPQVVPSSLNLVENARSVDLTCQTVN QSVNVQWFLSGQPLLPSEHLQLSADNRTLIIHGLQRNDTGPYACEVWNWGSRARSEPLELTINYGPDQVH ITRESASEMISTIEAELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNCTASN SLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELGYFLYIRNARRPSRKTTEDPSHETS QPIPKEEHPTEPSSESLSPEYCNISQLQGRIRVELMQPPDLPEETYETKLPSASRRGNSFSPWKPPPKPL MPPLRLVSTVPKNMESIYEELVNPEPNTYIQINPSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001096067 |
Locus ID | 125931 |
UniProt ID | Q6UY09 |
Refseq Size | 1809 |
Cytogenetics | 19q13.31 |
Refseq ORF | 1788 |
Synonyms | UNQ9366 |
Summary | Together with the tyrosine-protein kinase SYK, enhances production of the cytokine CXCL8/IL-8 via the NFKB pathway and may thus have a role in the intestinal immune response.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420166 | CEACAM20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC420167 | CEACAM20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC420168 | CEACAM20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC420169 | CEACAM20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY420166 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 5L |
CNY 4840.00 |
|
LY420167 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 4S |
CNY 4840.00 |
|
LY420168 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 4L |
CNY 4840.00 |
|
LY420169 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 5S |
CNY 4840.00 |
|
PH313248 | CEACAM20 MS Standard C13 and N15-labeled recombinant protein (NP_001096067) |
CNY 19520.00 |
其它CEACAM20产品