Bcl2 Binding component 3 (BBC3) (NM_014417) Human Recombinant Protein
CAT#: TP313203
Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 4, 20 µg
View other "Bcl2 Binding component 3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213203 representing NM_014417
Red=Cloning site Green=Tags(s) MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTA ALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQ LRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055232 |
| Locus ID | 27113 |
| UniProt ID | Q9BXH1 |
| Refseq Size | 1840 |
| Cytogenetics | 19q13.32 |
| Refseq ORF | 579 |
| Synonyms | JFY-1; JFY1; PUMA |
| Summary | This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Huntington's disease, p53 signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402330 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426734 | BBC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402330 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 4 |
CNY 3080.00 |
|
| LY426734 | Transient overexpression lysate of BCL2 binding component 3 (BBC3), transcript variant 1 |
CNY 3080.00 |
|
| PH313203 | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_055232) |
CNY 19520.00 |
|
| PH325345 | BBC3 MS Standard C13 and N15-labeled recombinant protein (NP_001120712) |
CNY 19520.00 |
|
| TP325345 | Recombinant protein of human BCL2 binding component 3 (BBC3), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Bcl2 Binding component 3产品


