TrkA (NTRK1) (NM_001012331) Human Recombinant Protein
CAT#: TP313091
Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, 20 µg
View other "TrkA" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213091 representing NM_001012331
Red=Cloning site Green=Tags(s) MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNLTCWAENDVGRAEVSVQV NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVGLAV FACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQY FSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTM LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAA GMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTT ESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKD VHARLQALAQAPPVYLDVLG TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 86.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001012331 |
| Locus ID | 4914 |
| UniProt ID | P04629 |
| Refseq Size | 2647 |
| Cytogenetics | 1q23.1 |
| Refseq ORF | 2370 |
| Synonyms | MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA |
| Summary | This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | Apoptosis, Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400383 | NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC419273 | NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423326 | NTRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400383 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 3 |
CNY 4840.00 |
|
| LY419273 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2 |
CNY 4840.00 |
|
| LY423326 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1 |
CNY 4840.00 |
|
| PH313091 | NTRK1 MS Standard C13 and N15-labeled recombinant protein (NP_001012331) |
CNY 19520.00 |
|
| TP700133 | Purified recombinant protein of Human neurotrophic tyrosine kinase receptor, type 1, transcript variant 2, with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP700134 | Purified recombinant protein of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP762465 | Purified recombinant protein of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 2, Asn440-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |


