RIPPLY3 (NM_018962) Human Recombinant Protein
CAT#: TP313078
Recombinant protein of human Down syndrome critical region gene 6 (DSCR6), 20 µg
View other "RIPPLY3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213078 representing NM_018962
Red=Cloning site Green=Tags(s) MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSK GAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEV GGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061835 |
Locus ID | 53820 |
UniProt ID | P57055 |
Refseq Size | 2262 |
Cytogenetics | 21q22.13 |
Refseq ORF | 570 |
Synonyms | DSCR6 |
Summary | Acts as a transcriptional corepressor. Negative regulator of the transcriptional activity of TBX1. Plays a role in the development of the pharyngeal apparatus and derivatives (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412850 | RIPPLY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412850 | Transient overexpression lysate of Down syndrome critical region gene 6 (DSCR6) |
CNY 3080.00 |
|
PH313078 | DSCR6 MS Standard C13 and N15-labeled recombinant protein (NP_061835) |
CNY 19520.00 |
其它RIPPLY3产品