PTPN20B (PTPN20) (NM_001042363) Human Recombinant Protein
CAT#: TP312878
Purified recombinant protein of Homo sapiens protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8, 20 µg
View other "PTPN20B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212878 representing NM_001042363
Red=Cloning site Green=Tags(s) MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILE EKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGE EYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQI LQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTG VFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 39 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035822 |
Locus ID | 26095 |
UniProt ID | Q4JDL3 |
Refseq Size | 2872 |
Cytogenetics | 10q11.22 |
Refseq ORF | 1017 |
Synonyms | bA42B19.1; bA142I17.1; CT126; PTPN20A; PTPN20B |
Summary | The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414452 | PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420847 | PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420852 | PTPN20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414452 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 2 |
CNY 3080.00 |
|
LY420847 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 3 |
CNY 3080.00 |
|
LY420852 | Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 8 |
CNY 3080.00 |
|
PH312878 | PTPN20B MS Standard C13 and N15-labeled recombinant protein (NP_001035822) |
CNY 14250.00 |
其它PTPN20B产品