ALKBH3 (NM_139178) Human Recombinant Protein
CAT#: TP312873
Recombinant protein of human alkB, alkylation repair homolog 3 (E. coli) (ALKBH3), 20 µg
View other "ALKBH3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212873 representing NM_139178
Red=Cloning site Green=Tags(s) MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR VIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIKEDITYQQPRLTAWYGELP YTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFG ATRTFEMRKKPPPEENGEYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_631917 |
Locus ID | 221120 |
UniProt ID | Q96Q83 |
Refseq Size | 1520 |
Cytogenetics | 11p11.2 |
Refseq ORF | 841 |
Synonyms | ABH3; DEPC-1; DEPC1; hABH3; PCA1 |
Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403381 | ALKBH3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403381 | Transient overexpression lysate of alkB, alkylation repair homolog 3 (E. coli) (ALKBH3) |
CNY 3080.00 |
|
PH312873 | ALKBH3 MS Standard C13 and N15-labeled recombinant protein (NP_631917) |
CNY 19520.00 |