MTH1 (NUDT1) (NM_198953) Human Recombinant Protein
CAT#: TP312808
Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A, 20 µg
View other "MTH1" proteins (24)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212808 representing NM_198953
Red=Cloning site Green=Tags(s) MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQI VFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ GQDTILDYTLREVDTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_945191 |
| Locus ID | 4521 |
| UniProt ID | P36639 |
| Refseq Size | 728 |
| Cytogenetics | 7p22.3 |
| Refseq ORF | 468 |
| Synonyms | MTH1 |
| Summary | Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A rare single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq, Dec 2018] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404632 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404633 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404634 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404636 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404637 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419314 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429104 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404632 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A |
CNY 3080.00 |
|
| LY404633 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B |
CNY 3080.00 |
|
| LY404634 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A |
CNY 3080.00 |
|
| LY404636 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A |
CNY 3080.00 |
|
| LY404637 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4B |
CNY 3080.00 |
|
| LY419314 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 |
CNY 3080.00 |
|
| PH301148 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945190) |
CNY 19520.00 |
|
| PH308551 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_002443) |
CNY 14250.00 |
|
| PH312655 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945186) |
CNY 19520.00 |
|
| PH312705 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945187) |
CNY 19520.00 |
|
| PH312761 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945188) |
CNY 14250.00 |
|
| PH312808 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945191) |
CNY 14250.00 |
|
| TP301148 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3B, 20 µg |
CNY 2900.00 |
|
| TP308551 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312655 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A, 20 µg |
CNY 2900.00 |
|
| TP312705 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B, 20 µg |
CNY 2900.00 |
|
| TP312761 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A, 20 µg |
CNY 2900.00 |


