KRTAP27-1 (NM_001077711) Human Recombinant Protein
CAT#: TP312779
Recombinant protein of human keratin associated protein 27-1 (KRTAP27-1), 20 µg
View other "KRTAP27-1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212779 representing NM_001077711
Red=Cloning site Green=Tags(s) MPHSHCHSLRSFHNAPPLSAITHGTNPITFEDRLCLPSSFHSRTCFLDNFQETCNETTSCQMTNCEQDLF TDDSCVQSNCFPGVVQTTYSNSRPCERTACQSESSSAGLACVSQPCQSESTQQMGFVAQSCQPASLKGNS CPPKTSKSKNFETLERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESSPGVEPTCCVTGGSQLPSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001071179 |
| Locus ID | 643812 |
| UniProt ID | Q3LI81 |
| Refseq Size | 682 |
| Cytogenetics | 21q22.11 |
| Refseq ORF | 621 |
| Summary | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421490 | KRTAP27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421490 | Transient overexpression lysate of keratin associated protein 27-1 (KRTAP27-1) |
CNY 3080.00 |
|
| PH312779 | KRTAP27 MS Standard C13 and N15-labeled recombinant protein (NP_001071179) |
CNY 19520.00 |
其它KRTAP27-1产品

