SNAP25 (NM_130811) Human Recombinant Protein
CAT＃: TP312596
Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2, 20 µg
View other "SNAP25" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212596 representing NM_130811
Red=Cloning site Green=Tags(s) MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570824 |
| Locus ID | 6616 |
| UniProt ID | P60880 |
| Refseq Size | 2053 |
| Cytogenetics | 20p12.2 |
| Refseq ORF | 618 |
| Synonyms | bA416N4.2; CMS18; dJ1068F16.2; RIC-4; RIC4; SEC9; SNAP; SNAP-25; SUP |
| Summary | Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408904 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418912 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408904 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 |
CNY 3080.00 |
|
| LY418912 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1 |
CNY 3080.00 |
|
| PH302068 | SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_003072) |
CNY 19520.00 |
|
| PH312596 | SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_570824) |
CNY 19520.00 |
|
| TP302068 | Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1, 20 µg |
CNY 2900.00 |
