TMEM231 (NM_001077418) Human Recombinant Protein
CAT#: TP312590
Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 2, 20 µg
View other "TMEM231" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212590 representing NM_001077418
Red=Cloning site Green=Tags(s) MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001070886 |
| Locus ID | 79583 |
| UniProt ID | Q9H6L2 |
| Refseq Size | 2911 |
| Cytogenetics | 16q23.1 |
| Refseq ORF | 948 |
| Synonyms | ALYE870; JBTS20; MKS11; PRO1886 |
| Summary | This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421412 | TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421413 | TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421412 | Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 1 |
CNY 3080.00 |
|
| LY421413 | Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 2 |
CNY 3080.00 |
|
| PH312590 | TMEM231 MS Standard C13 and N15-labeled recombinant protein (NP_001070886) |
CNY 19520.00 |
|
| TP303675 | Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 3, 20 µg |
CNY 2900.00 |
其它TMEM231产品
