P15RS (RPRD1A) (NM_018170) Human Recombinant Protein
CAT#: TP312551
Recombinant protein of human regulation of nuclear pre-mRNA domain containing 1A (RPRD1A), 20 µg
View other "P15RS" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212551 representing NM_018170
Red=Cloning site Green=Tags(s) MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQNS KRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTY EQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLLDKITDKESGE RLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELR SRIQSLPDLSRLPNVTGSHMHLPFAGDIYSED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060640 |
Locus ID | 55197 |
UniProt ID | Q96P16 |
Refseq Size | 4284 |
Cytogenetics | 18q12.2 |
Refseq ORF | 936 |
Synonyms | HsT3101; P15RS |
Summary | This gene encodes a cell-cycle and transcription regulatory protein. The encoded protein interacts with the cell cycle inhibitor cyclin-dependent kinase 4 inhibitor B and may function as a negative regulator of G(1)/S phase progression. This protein also forms homo- and hetrodimers with the protein, regulation of nuclear pre-mRNA domain-containing protein 1B, to form a scaffold that interacts with the C-terminal domain of RNA polymerase II subunit B1 and regulates several aspects of transcription. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 16. [provided by RefSeq, Dec 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413267 | RPRD1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413267 | Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1A (RPRD1A) |
CNY 3080.00 |
|
PH312551 | RPRD1A MS Standard C13 and N15-labeled recombinant protein (NP_060640) |
CNY 19520.00 |