IKBKE (NM_014002) Human Recombinant Protein
CAT#: TP312481
Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE), 20 µg
View other "IKBKE" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212481 representing NM_014002
Red=Cloning site Green=Tags(s) MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKL FAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGN IMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVT LYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPI LANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQ EYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELK AAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKS RMRPGLGYNEEQIHKLDKVNFSHLDKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAA CNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDN NRIIERLNRVPAPPDV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 80.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054721 |
| Locus ID | 9641 |
| UniProt ID | Q14164 |
| Refseq Size | 3263 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 2148 |
| Synonyms | IKK-E; IKK-i; IKKE; IKKI |
| Summary | IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast carcinomas and breast cancer cell lines (Hutti et al., 2009 [PubMed 19481526]).[supplied by OMIM, Oct 2009] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
SAMHD1 impairs type I interferon induction through the MAVS, IKKε, and IRF7 signaling axis during viral infection
,null,
The Journal of Biological Chemistry
,PubMed ID 37328105
[IKBKE]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415533 | IKBKE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY415533 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon (IKBKE) |
CNY 4840.00 |
|
| PH312481 | IKBKE MS Standard C13 and N15-labeled recombinant protein (NP_054721) |
CNY 19520.00 |
