Parvalbumin (PVALB) (NM_002854) Human Recombinant Protein
CAT#: TP312427
Recombinant protein of human parvalbumin (PVALB), 20 µg
View other "Parvalbumin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212427 protein sequence
Red=Cloning site Green=Tags(s) MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKG FSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002845 |
Locus ID | 5816 |
UniProt ID | P20472 |
Refseq Size | 586 |
Cytogenetics | 22q12.3 |
Refseq ORF | 330 |
Synonyms | D22S749 |
Summary | The protein encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419082 | PVALB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419082 | Transient overexpression lysate of parvalbumin (PVALB) |
CNY 3080.00 |
|
PH312427 | PVALB MS Standard C13 and N15-labeled recombinant protein (NP_002845) |
CNY 19520.00 |
|
TP720135 | Recombinant protein of human parvalbumin (PVALB) |
CNY 1800.00 |
其它Parvalbumin产品