PDE4D (NM_006203) Human Recombinant Protein
CAT＃: TP312410
Recombinant protein of human phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) (PDE4D), transcript variant 2, 20 µg
View other "PDE4D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212410 representing NM_006203
Red=Cloning site Green=Tags(s) MHVNNFPFRRHSWICFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMS RNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLA SETLEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIP SPTQKEKEKKKRPMSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGN RPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVF TDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKK QRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKP LQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDI LDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKT LCTQDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 76.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006194 |
| Locus ID | 5144 |
| UniProt ID | Q08499 |
| Refseq Size | 5876 |
| Cytogenetics | 5q11.2-q12.1 |
| Refseq ORF | 2016 |
| Synonyms | ACRDYS2; DPDE3; HSPDE4D; PDE4DN2; PDE43; STRK1 |
| Summary | This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.[provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401868 | PDE4D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC434324 | PDE4D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434368 | PDE4D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401868 | Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) (PDE4D), transcript variant 2 |
CNY 4840.00 |
|
| LY434324 | Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 8 |
CNY 3080.00 |
|
| LY434368 | Transient overexpression lysate of phosphodiesterase 4D, cAMP-specific (PDE4D), transcript variant 6 |
CNY 4840.00 |
|
| PH312410 | PDE4D MS Standard C13 and N15-labeled recombinant protein (NP_006194) |
CNY 19520.00 |
