ADAT2 (NM_182503) Human Recombinant Protein
CAT#: TP312395
Recombinant protein of human adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae) (ADAT2), 20 µg
View other "ADAT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212395 representing NM_182503
Red=Cloning site Green=Tags(s) MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATR HAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNI ASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872309 |
Locus ID | 134637 |
UniProt ID | Q7Z6V5 |
Refseq Size | 6270 |
Cytogenetics | 6q24.2 |
Refseq ORF | 573 |
Synonyms | DEADC1; dJ20N2; dJ20N2.1; TAD2 |
Summary | Probably participates in deamination of adenosine-34 to inosine in many tRNAs.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405523 | ADAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405523 | Transient overexpression lysate of adenosine deaminase, tRNA-specific 2, TAD2 homolog (S. cerevisiae) (ADAT2) |
CNY 3080.00 |
|
PH312395 | ADAT2 MS Standard C13 and N15-labeled recombinant protein (NP_872309) |
CNY 19520.00 |