Breast cancer suppressor candidate 1 (VWA5A) (NM_014622) Human Recombinant Protein
CAT#: TP312185
Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, 20 µg
View other "Breast cancer suppressor candidate 1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212185 representing NM_014622
Red=Cloning site Green=Tags(s) MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFG IGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTV IFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMG LRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQGPLAHRDVPRPILLGASAPLKIKCQSGFRK ALHSDRPPSASQPRGELMCYKAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKA AITFLKSSVDPAIFAF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 86.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055437 |
| Locus ID | 4013 |
| UniProt ID | O00534 |
| Refseq Size | 3438 |
| Cytogenetics | 11q24.2 |
| Refseq ORF | 2358 |
| Synonyms | BCSC-1; BCSC1; LOH11CR2A |
| Summary | May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402354 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405013 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427178 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402354 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1 |
CNY 4840.00 |
|
| LY405013 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2 |
CNY 3080.00 |
|
| LY427178 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3 |
CNY 4840.00 |
|
| PH301474 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057) |
CNY 19520.00 |
|
| PH312185 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_055437) |
CNY 19520.00 |
|
| PH326168 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614) |
CNY 19520.00 |
|
| TP301474 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326168 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP710317 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP761749 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Breast cancer suppressor candidate 1产品
