VSIG8 (NM_001013661) Human Recombinant Protein
CAT#: TP312118
Recombinant protein of human V-set and immunoglobulin domain containing 8 (VSIG8), 20 µg
View other "VSIG8" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212118 representing NM_001013661
Red=Cloning site Green=Tags(s) MRVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPA HHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIV TVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQES FHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIGVIIGIVLGSLLALGCLA VGIWGLVCCCCGGSGAGGARGAFGYGNGGGVGGGACGDLASEIREDAVAPGCKASGRGSRVTHLLGYPTQ NVSRSLRRKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001013683 |
| Locus ID | 391123 |
| UniProt ID | P0DPA2 |
| Refseq Size | 1818 |
| Cytogenetics | 1q23.2 |
| Refseq ORF | 1242 |
| Protein Families | Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Localization of the Novel Hair Shaft Protein VSIG8 in the Hair Follicle, Nail Unit and Oral Cavity
,null,
The Journal of investigative dermatology
,PubMed ID 21614015
[VSIG8]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423010 | VSIG8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423010 | Transient overexpression lysate of V-set and immunoglobulin domain containing 8 (VSIG8) |
CNY 3080.00 |
|
| PH312118 | VSIG8 MS Standard C13 and N15-labeled recombinant protein (NP_001013683) |
CNY 19520.00 |
