MS4A7 (NM_206939) Human Recombinant Protein
CAT#: TP312066
Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 3, 20 µg
View other "MS4A7" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212066 protein sequence
Red=Cloning site Green=Tags(s) MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAP YPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMV ALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQL YSNNPGSSFSSTQSQDHIQQVKKSSSRSWI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_996822 |
Locus ID | 58475 |
UniProt ID | Q9GZW8 |
Refseq Size | 2976 |
Cytogenetics | 11q12.2 |
Refseq ORF | 720 |
Synonyms | 4SPAN2; CD20L4; CFFM4; MS4A8 |
Summary | This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404181 | MS4A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404182 | MS4A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412040 | MS4A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404181 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 2 |
CNY 3080.00 |
|
LY404182 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 3 |
CNY 3080.00 |
|
LY412040 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 1 |
CNY 3080.00 |
|
PH312066 | MS4A7 MS Standard C13 and N15-labeled recombinant protein (NP_996822) |
CNY 19520.00 |