SEC14L1 (NM_003003) Human Recombinant Protein
CAT#: TP311801
Recombinant protein of human SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 1, 20 µg
View other "SEC14L1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211801 representing NM_003003
Red=Cloning site Green=Tags(s) MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLK KIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPENEDWTCFEQSASLDIKSFFGF ESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPE AALKEGLSGDALSSPSAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMD TKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE CMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDI VFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQGSHVTRWPG FYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAA TTSSSQSHSSSMISR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 81.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002994 |
| Locus ID | 6397 |
| UniProt ID | Q92503 |
| Refseq Size | 5434 |
| Cytogenetics | 17q25.2-q25.3 |
| Refseq ORF | 2145 |
| Synonyms | PRELID4A; SEC14L |
| Summary | The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene; some variants represent read-through transcripts that include exons from the upstream gene C17orf86. [provided by RefSeq, Feb 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418958 | SEC14L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428458 | SEC14L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428459 | SEC14L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418958 | Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 1 |
CNY 4840.00 |
|
| LY428458 | Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 3 |
CNY 4840.00 |
|
| LY428459 | Transient overexpression lysate of SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 4 |
CNY 4840.00 |
|
| PH311801 | SEC14L1 MS Standard C13 and N15-labeled recombinant protein (NP_002994) |
CNY 19520.00 |
|
| PH326531 | SEC14L1 MS Standard C13 and N15-labeled recombinant protein (NP_001137470) |
CNY 19520.00 |
|
| PH326540 | SEC14L1 MS Standard C13 and N15-labeled recombinant protein (NP_001137471) |
CNY 19520.00 |
|
| TP326531 | Recombinant protein of human SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP326540 | Recombinant protein of human SEC14-like 1 (S. cerevisiae) (SEC14L1), transcript variant 4, 20 µg |
CNY 2900.00 |
其它SEC14L1产品
