RNF22 (TRIM3) (NM_006458) Human Recombinant Protein
CAT＃: TP311739
Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 1, 20 µg
View other "RNF22" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211739 representing NM_006458
Red=Cloning site Green=Tags(s) MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 80.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006449 |
| Locus ID | 10612 |
| UniProt ID | O75382 |
| Refseq Size | 3059 |
| Cytogenetics | 11p15.4 |
| Refseq ORF | 2232 |
| Synonyms | BERP; HAC1; RNF22; RNF97 |
| Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also called the 'RING-B-box-coiled-coil' (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic filaments. It is similar to a rat protein which is a specific partner for the tail domain of myosin V, a class of myosins which are involved in the targeted transport of organelles. The rat protein can also interact with alpha-actinin-4. Thus it is suggested that this human protein may play a role in myosin V-mediated cargo transport. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409625 | TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416642 | TRIM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY409625 | Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 2 |
CNY 3080.00 |
|
| LY416642 | Transient overexpression lysate of tripartite motif-containing 3 (TRIM3), transcript variant 1 |
CNY 4840.00 |
|
| PH311739 | TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_006449) |
CNY 19520.00 |
|
| PH311928 | TRIM3 MS Standard C13 and N15-labeled recombinant protein (NP_150594) |
CNY 19520.00 |
|
| TP311928 | Recombinant protein of human tripartite motif-containing 3 (TRIM3), transcript variant 2, 20 µg |
CNY 2900.00 |
