NFKBID (NM_139239) Human Recombinant Protein
CAT#: TP311589
Recombinant protein of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, delta (NFKBID), 20 µg
View other "NFKBID" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211589 protein sequence
Red=Cloning site Green=Tags(s) MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAE VLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNS GVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTV LHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLE NEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_640332 |
Locus ID | 84807 |
UniProt ID | Q8NI38 |
Refseq Size | 1834 |
Cytogenetics | 19q13.12 |
Refseq ORF | 939 |
Synonyms | IkappaBNS; IkBNS; TA-NFKBH |
Summary | Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR). May also regulate TCR-induced negative selection of thymocytes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408361 | NFKBID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408361 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, delta (NFKBID) |
CNY 3080.00 |
|
PH311589 | NFKBID MS Standard C13 and N15-labeled recombinant protein (NP_640332) |
CNY 19520.00 |