BTK (NM_000061) Human Recombinant Protein
CAT#: TP311582
Recombinant protein of human Bruton agammaglobulinemia tyrosine kinase (BTK), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211582 representing NM_000061
Red=Cloning site Green=Tags(s) MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPE KNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ KYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAP VSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYE WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR HRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIM YSCWHEKADERPTFKILLSNILDVMDEES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 76.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000052 |
| Locus ID | 695 |
| UniProt ID | Q06187 |
| Refseq Size | 2591 |
| Cytogenetics | Xq22.1 |
| Refseq ORF | 1977 |
| Synonyms | AGMX1; AT; ATK; BPK; IGHD3; IMD1; PSCTK1; XLA |
| Summary | The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Primary immunodeficiency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424947 | BTK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY424947 | Transient overexpression lysate of Bruton agammaglobulinemia tyrosine kinase (BTK) |
CNY 4840.00 |
|
| PH311582 | BTK MS Standard C13 and N15-labeled recombinant protein (NP_000052) |
CNY 19520.00 |
|
| TP710016 | Recombinant protein of human Bruton agammaglobulinemia tyrosine kinase (BTK),full length, with C-terminal polyhistidine tag, expressed in sf9 cell |
CNY 4020.00 |


